Lineage for d4hl7b1 (4hl7 B:4-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944970Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) (S)
  5. 2945049Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2945050Protein automated matches [226878] (11 species)
    not a true protein
  7. 2945229Species Vibrio cholerae [TaxId:243277] [226020] (2 PDB entries)
  8. 2945231Domain d4hl7b1: 4hl7 B:4-150 [252461]
    Other proteins in same PDB: d4hl7a2, d4hl7a3, d4hl7b2, d4hl7b3
    automated match to d3os4a1
    complexed with so4

Details for d4hl7b1

PDB Entry: 4hl7 (more details), 1.8 Å

PDB Description: crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae
PDB Compounds: (B:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d4hl7b1:

Sequence, based on SEQRES records: (download)

>d4hl7b1 d.41.2.0 (B:4-150) automated matches {Vibrio cholerae [TaxId: 243277]}
nprlfsphiirslldldaykinmmqaihhfypdvsvryelivrseedasglldairqeia
hlgtlrfsdadihyltqhaphlkatflqslryfhfvpqeqvemgivkqggkqqlrisirg
swrdtilyetlvmaivsevrsrqrwae

Sequence, based on observed residues (ATOM records): (download)

>d4hl7b1 d.41.2.0 (B:4-150) automated matches {Vibrio cholerae [TaxId: 243277]}
nprlfsphiirslldldaykinmmqaihhfypdvsvryelivrseedasglldairqeia
hlgtlrfsdadihyltqhaphlkatflqslryfhfvpqeqvemgivkgkqqlrisirgsw
rdtilyetlvmaivsevrsrqrwae

SCOPe Domain Coordinates for d4hl7b1:

Click to download the PDB-style file with coordinates for d4hl7b1.
(The format of our PDB-style files is described here.)

Timeline for d4hl7b1: