Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
Species Escherichia coli [TaxId:562] [50254] (3 PDB entries) |
Domain d1c0aa1: 1c0a A:1-106 [25246] Other proteins in same PDB: d1c0aa2, d1c0aa3 protein/RNA complex; complexed with amo, amp, so4 |
PDB Entry: 1c0a (more details), 2.4 Å
SCOPe Domain Sequences for d1c0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla selrnefciqvtgtvrardekninrdmatgeievlassltiinrad
Timeline for d1c0aa1: