Lineage for d1c0aa1 (1c0a A:1-106)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124636Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1124637Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 1124644Species Escherichia coli [TaxId:562] [50254] (3 PDB entries)
  8. 1124645Domain d1c0aa1: 1c0a A:1-106 [25246]
    Other proteins in same PDB: d1c0aa2, d1c0aa3
    protein/RNA complex; complexed with amo, amp, so4

Details for d1c0aa1

PDB Entry: 1c0a (more details), 2.4 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase : trnaasp : aspartyl-adenylate complex
PDB Compounds: (A:) aspartyl tRNA synthetase

SCOPe Domain Sequences for d1c0aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
selrnefciqvtgtvrardekninrdmatgeievlassltiinrad

SCOPe Domain Coordinates for d1c0aa1:

Click to download the PDB-style file with coordinates for d1c0aa1.
(The format of our PDB-style files is described here.)

Timeline for d1c0aa1: