SCOPe 2.08: Domain d4hl0b1: 4hl0 B:1-144

Lineage for d4hl0b1 (4hl0 B:1-144)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)

8. Domain d4hl0b1: 4hl0 B:1-144 [252459]
   automated match to d3i8ta_

Details for d4hl0b1

PDB Entry: 4hl0, 2 Å

PDB Description: Crystal structure of full-length Toxascaris leonina galectin

PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d4hl0b1:

Sequence; same for both SEQRES and ATOM records:

>d4hl0b1 b.29.1.0 (B:1-144) automated matches {Toxascaris leonina [TaxId: 59264]}
matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
plssvthfsvdgdilityihwggk

Timeline for d4hl0b1:

• d4hl0b1 first appeared in SCOPe 2.04
  
• d4hl0b1 appears in SCOPe 2.07