Lineage for d4hl0a2 (4hl0 A:145-278)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782173Species Toxascaris leonina [TaxId:59264] [256287] (1 PDB entry)
  8. 1782175Domain d4hl0a2: 4hl0 A:145-278 [252458]
    automated match to d3i8ta_

Details for d4hl0a2

PDB Entry: 4hl0 (more details), 2 Å

PDB Description: Crystal structure of full-length Toxascaris leonina galectin
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d4hl0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hl0a2 b.29.1.0 (A:145-278) automated matches {Toxascaris leonina [TaxId: 59264]}
yypvpyesglagdglapgksllifatpekkgkrfhinllkkngdialhfnprfdekaivr
nslisgewgneeregknplekgigcdlefrneeyafqiyvdgerfatyahrldphdingl
qiggdvevtgiqmv

SCOPe Domain Coordinates for d4hl0a2:

Click to download the PDB-style file with coordinates for d4hl0a2.
(The format of our PDB-style files is described here.)

Timeline for d4hl0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hl0a1