Lineage for d4hk3n1 (4hk3 N:1-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357486Domain d4hk3n1: 4hk3 N:1-109 [252455]
    Other proteins in same PDB: d4hk3n2
    automated match to d1aqkl1

Details for d4hk3n1

PDB Entry: 4hk3 (more details), 3 Å

PDB Description: i2 fab (unbound) from ch65-ch67 lineage
PDB Compounds: (N:) I2 light chain

SCOPe Domain Sequences for d4hk3n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hk3n1 b.1.1.0 (N:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlg

SCOPe Domain Coordinates for d4hk3n1:

Click to download the PDB-style file with coordinates for d4hk3n1.
(The format of our PDB-style files is described here.)

Timeline for d4hk3n1: