Lineage for d4hhta_ (4hht A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2886080Protein automated matches [190266] (7 species)
    not a true protein
  7. 2886108Species Thermotoga maritima [TaxId:2336] [189559] (4 PDB entries)
  8. 2886112Domain d4hhta_: 4hht A: [252454]
    automated match to d3o3ga_
    protein/DNA complex; complexed with ca

Details for d4hhta_

PDB Entry: 4hht (more details), 3.1 Å

PDB Description: t. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d4hhta_:

Sequence, based on SEQRES records: (download)

>d4hhta_ c.55.3.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
gidelykkefgivagvdeasrgclagpvvaaavvlekeiegindskqlspakrerlldei
mekaavgigiaspeeidlynifnatklamnralenlsvkpsfvlvdgkgielsvpgtclv
kgdqkskligaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpih
rlsfepvlelltddllreffekglisenrferilnllgarksvvfrker

Sequence, based on observed residues (ATOM records): (download)

>d4hhta_ c.55.3.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
gidelykkefgivagvdeasrgclagpvvaaavvlekeiegindsrlldeimekaavgig
iaspeeidlynifnatklamnralenlsvkpsfvlvdgkgielsvpgtclvkgdqkskli
gaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpihrlsfepvle
lltddllreffekglisenrferilnllgarksvvfrker

SCOPe Domain Coordinates for d4hhta_:

Click to download the PDB-style file with coordinates for d4hhta_.
(The format of our PDB-style files is described here.)

Timeline for d4hhta_: