Lineage for d4hgvc_ (4hgv C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010501Species Sinorhizobium meliloti [TaxId:266834] [256286] (1 PDB entry)
  8. 2010504Domain d4hgvc_: 4hgv C: [252452]
    automated match to d1fuob_
    complexed with so4

Details for d4hgvc_

PDB Entry: 4hgv (more details), 2.09 Å

PDB Description: Crystal structure of a fumarate hydratase
PDB Compounds: (C:) fumarate hydratase class II

SCOPe Domain Sequences for d4hgvc_:

Sequence, based on SEQRES records: (download)

>d4hgvc_ a.127.1.0 (C:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
strtetdtfgpievasdrywgaqaqrslgnfkigwekqplaivralgivkqaaaranmal
grldpaigdaivkaaqevidgkldehfplvvwqtgsgtqsnmnanevvsnraiellggvm
gskkpvhpndhvnmsqssndtyptamhiacaervihdllpalkhlhkaleekvkafdhii
kigrthtqdatpltlgqefsgyaaqvassikriemtlpglcelaqggtavgtglnapvgf
aekvaeeiaaitgigftsapnkfealaahdsmvfshgainataaalfkiandirflgsgp
rsglgelslpenepgssimpgkvnptqcealtqvcvqvfgnhaaltfagsqghfelnvyn
plmaynflqsvqlladaaisftdncvvgiearednikaaldrslmlvtalapkigydnaa
kiaktahkngttlreeavgggyvtdeefdavvrpetmigp

Sequence, based on observed residues (ATOM records): (download)

>d4hgvc_ a.127.1.0 (C:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
strtetdtfgpievasdrywgaqaqrslgnfkigwekqplaivralgivkqaaaranmal
grldpaigdaivkaaqevidgkldehfplvvwqtgsgtqsnmnanevvsnraiellggvm
gskkpvhpndhvnmsqssndtyptamhiacaervihdllpalkhlhkaleekvkafdhii
kigrthtqdatpltlgqefsgyaaqvassikriemtlpglcelaqggtavgtglnapvgf
aekvaeeiaaitgigftsapnkfealaahdsmvfshgainataaalfkiandirflgsgp
rsglgelslpenepgsmpgkvnptqcealtqvcvqvfgnhaaltfagsqghfelnvynpl
maynflqsvqlladaaisftdncvvgiearednikaaldrslmlpetmigp

SCOPe Domain Coordinates for d4hgvc_:

Click to download the PDB-style file with coordinates for d4hgvc_.
(The format of our PDB-style files is described here.)

Timeline for d4hgvc_: