Lineage for d1b8ab1 (1b8a B:1001-1103)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229104Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 229105Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 229106Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry)
  8. 229108Domain d1b8ab1: 1b8a B:1001-1103 [25245]
    Other proteins in same PDB: d1b8aa2, d1b8ab2
    complexed with atp, mn

Details for d1b8ab1

PDB Entry: 1b8a (more details), 1.9 Å

PDB Description: aspartyl-trna synthetase

SCOP Domain Sequences for d1b8ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ab1 b.40.4.1 (B:1001-1103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet

SCOP Domain Coordinates for d1b8ab1:

Click to download the PDB-style file with coordinates for d1b8ab1.
(The format of our PDB-style files is described here.)

Timeline for d1b8ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8ab2