SCOP 1.55: Domain d1b8ab1: 1b8a B:1001-1103

Lineage for d1b8ab1 (1b8a B:1001-1103)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)

7. Species Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry)

8. Domain d1b8ab1: 1b8a B:1001-1103 [25245]
   Other proteins in same PDB: d1b8aa2, d1b8ab2

Details for d1b8ab1

PDB Entry: 1b8a, 1.9 Å

PDB Description: aspartyl-trna synthetase

SCOP Domain Sequences for d1b8ab1:

Sequence; same for both SEQRES and ATOM records:

>d1b8ab1 b.40.4.1 (B:1001-1103) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet

Timeline for d1b8ab1:

• d1b8ab1 appears in SCOP 1.57
  
• d1b8ab1 appears in the current release, SCOPe 2.08