SCOPe 2.08: Domain d1b8ab1: 1b8a B:1001-1103

Lineage for d1b8ab1 (1b8a B:1001-1103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
   this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes

7. Species Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry)

8. Domain d1b8ab1: 1b8a B:1001-1103 [25245]
   Other proteins in same PDB: d1b8aa2, d1b8ab2
   complexed with atp, mn

Details for d1b8ab1

PDB Entry: 1b8a, 1.9 Å

PDB Description: aspartyl-trna synthetase

PDB Compounds: (B:) protein (aspartyl-tRNA synthetase)

SCOPe Domain Sequences for d1b8ab1:

Sequence; same for both SEQRES and ATOM records:

>d1b8ab1 b.40.4.1 (B:1001-1103) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis [TaxId: 311400]}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet

Timeline for d1b8ab1:

• d1b8ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1b8ab1 appears in SCOPe 2.07