SCOPe 2.04: Domain d4hgsa_: 4hgs A:

Lineage for d4hgsa_ (4hgs A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)

8. Domain d4hgsa_: 4hgs A: [252449]
   automated match to d2c47d_
   complexed with 15g

Details for d4hgsa_

PDB Entry: 4hgs, 2.4 Å

PDB Description: Crystal structure of ck1gs with compound 13

PDB Compounds: (A:) casein kinase I isoform gamma-3

SCOPe Domain Sequences for d4hgsa_:

Sequence; same for both SEQRES and ATOM records:

>d4hgsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
vhsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgt
arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
pv

Timeline for d4hgsa_:

• d4hgsa_ is new in SCOPe 2.04-stable
  
• d4hgsa_ appears in SCOPe 2.05
  
• d4hgsa_ appears in the current release, SCOPe 2.08, called d4hgsa1