SCOPe 2.05: Domain d4hgla_: 4hgl A:

Lineage for d4hgla_ (4hgl A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)

8. Domain d4hgla_: 4hgl A: [252448]
   automated match to d2c47d_
   complexed with 0yo, so4

Details for d4hgla_

PDB Entry: 4hgl, 2.4 Å

PDB Description: Crystal structure of ck1g3 with compound 1

PDB Compounds: (A:) casein kinase I isoform gamma-3

SCOPe Domain Sequences for d4hgla_:

Sequence; same for both SEQRES and ATOM records:

>d4hgla_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
vhsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgt
arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
pv

Timeline for d4hgla_:

• d4hgla_ first appeared in SCOPe 2.04
  
• d4hgla_ is called d4hgla1 in SCOPe 2.06
  
• d4hgla_ appears in the current release, SCOPe 2.08, called d4hgla1