SCOPe 2.08: Domain d4hgla1: 4hgl A:34-334

Lineage for d4hgla1 (4hgl A:34-334)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d4hgla1: 4hgl A:34-334 [252448]
   Other proteins in same PDB: d4hgla2
   automated match to d2c47d_
   complexed with 0yo, so4

Details for d4hgla1

PDB Entry: 4hgl, 2.4 Å

PDB Description: Crystal structure of ck1g3 with compound 1

PDB Compounds: (A:) casein kinase I isoform gamma-3

SCOPe Domain Sequences for d4hgla1:

Sequence; same for both SEQRES and ATOM records:

>d4hgla1 d.144.1.7 (A:34-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykql
gsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyv
hsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgta
rymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpi
evlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlptp
v

Timeline for d4hgla1:

• d4hgla1 first appeared in SCOPe 2.04, called d4hgla_
  
• d4hgla1 appears in SCOPe 2.07