Lineage for d1b8aa1 (1b8a A:1-103)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799408Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 799409Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 799410Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry)
  8. 799411Domain d1b8aa1: 1b8a A:1-103 [25244]
    Other proteins in same PDB: d1b8aa2, d1b8ab2

Details for d1b8aa1

PDB Entry: 1b8a (more details), 1.9 Å

PDB Description: aspartyl-trna synthetase
PDB Compounds: (A:) protein (aspartyl-tRNA synthetase)

SCOP Domain Sequences for d1b8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet

SCOP Domain Coordinates for d1b8aa1:

Click to download the PDB-style file with coordinates for d1b8aa1.
(The format of our PDB-style files is described here.)

Timeline for d1b8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8aa2