Class b: All beta proteins [48724] (119 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry) |
Domain d1b8aa1: 1b8a A:1-103 [25244] Other proteins in same PDB: d1b8aa2, d1b8ab2 |
PDB Entry: 1b8a (more details), 1.9 Å
SCOP Domain Sequences for d1b8aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis} myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet
Timeline for d1b8aa1: