Lineage for d1b8aa1 (1b8a A:1-103)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14053Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 14054Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)
  7. 14066Species Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry)
  8. 14067Domain d1b8aa1: 1b8a A:1-103 [25244]
    Other proteins in same PDB: d1b8aa2, d1b8ab2

Details for d1b8aa1

PDB Entry: 1b8a (more details), 1.9 Å

PDB Description: aspartyl-trna synthetase

SCOP Domain Sequences for d1b8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet

SCOP Domain Coordinates for d1b8aa1:

Click to download the PDB-style file with coordinates for d1b8aa1.
(The format of our PDB-style files is described here.)

Timeline for d1b8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8aa2