Lineage for d4hfua_ (4hfu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778324Domain d4hfua_: 4hfu A: [252436]
    Other proteins in same PDB: d4hfub_, d4hful1, d4hful2
    automated match to d1rd8a_

Details for d4hfua_

PDB Entry: 4hfu (more details), 3.11 Å

PDB Description: crystal structure of fab 8m2 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4hfua_:

Sequence, based on SEQRES records: (download)

>d4hfua_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkyllssvkhfekvkilp
kdrwtqhtttggsracavsgnpsffrnmvwltkkgsdypvakgsynntsgeqmliiwgvh
hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdti
nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
gecpryvkseklvlatglrnvp

Sequence, based on observed residues (ATOM records): (download)

>d4hfua_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
gwllgnpecdrllsvpewsyimekenprlcypgsfndyeelkyllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltkkgsdypvakgsynntsgeqmliiwgvhhp
ndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpryvkseklvlatglrnvp

SCOPe Domain Coordinates for d4hfua_:

Click to download the PDB-style file with coordinates for d4hfua_.
(The format of our PDB-style files is described here.)

Timeline for d4hfua_: