Lineage for d4hfua1 (4hfu A:10-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040531Domain d4hfua1: 4hfu A:10-324 [252436]
    Other proteins in same PDB: d4hfua2, d4hfub_, d4hful1, d4hful2
    automated match to d1rd8a_

Details for d4hfua1

PDB Entry: 4hfu (more details), 3.11 Å

PDB Description: crystal structure of fab 8m2 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4hfua1:

Sequence, based on SEQRES records: (download)

>d4hfua1 b.19.1.2 (A:10-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkyllssvkhfekvkilpk
drwtqhtttggsracavsgnpsffrnmvwltkkgsdypvakgsynntsgeqmliiwgvhh
pndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtin
festgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltig
ecpryvkseklvlatglrnvp

Sequence, based on observed residues (ATOM records): (download)

>d4hfua1 b.19.1.2 (A:10-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprlcypgsfndyeelkyllssvkhfekvkilpkdr
wtqhtttggsracavsgnpsffrnmvwltkkgsdypvakgsynntsgeqmliiwgvhhpn
deteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfe
stgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigec
pryvkseklvlatglrnvp

SCOPe Domain Coordinates for d4hfua1:

Click to download the PDB-style file with coordinates for d4hfua1.
(The format of our PDB-style files is described here.)

Timeline for d4hfua1: