Lineage for d4hfol_ (4hfo L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1552567Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 1552568Protein automated matches [190698] (14 species)
    not a true protein
  7. 1552640Species Rhodnius prolixus [TaxId:13249] [193297] (3 PDB entries)
  8. 1552656Domain d4hfol_: 4hfo L: [252435]
    automated match to d4ge1a_

Details for d4hfol_

PDB Entry: 4hfo (more details), 3 Å

PDB Description: biogenic amine-binding protein selenomethionine derivative
PDB Compounds: (L:) Biogenic amine-binding protein

SCOPe Domain Sequences for d4hfol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hfol_ b.60.1.0 (L:) automated matches {Rhodnius prolixus [TaxId: 13249]}
sgcstvdtvkdfnkdnfftgswymthyklgdstlevgdknctkflhqktadgkikevfsn
ynpnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysv
vhvcdpaapdyymyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqydde
tlqkllkqsfpnye

SCOPe Domain Coordinates for d4hfol_:

Click to download the PDB-style file with coordinates for d4hfol_.
(The format of our PDB-style files is described here.)

Timeline for d4hfol_: