Lineage for d4hfok_ (4hfo K:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063481Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2063482Protein automated matches [190698] (21 species)
    not a true protein
  7. 2063570Species Rhodnius prolixus [TaxId:13249] [193297] (8 PDB entries)
  8. 2063590Domain d4hfok_: 4hfo K: [252434]
    automated match to d4ge1a_

Details for d4hfok_

PDB Entry: 4hfo (more details), 3 Å

PDB Description: biogenic amine-binding protein selenomethionine derivative
PDB Compounds: (K:) Biogenic amine-binding protein

SCOPe Domain Sequences for d4hfok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hfok_ b.60.1.0 (K:) automated matches {Rhodnius prolixus [TaxId: 13249]}
cstvdtvkdfnkdnfftgswymthyklgdstlevgdknctkflhqktadgkikevfsnyn
pnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysvvh
vcdpaapdyymyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqyddetl
qkllkqsfpnyek

SCOPe Domain Coordinates for d4hfok_:

Click to download the PDB-style file with coordinates for d4hfok_.
(The format of our PDB-style files is described here.)

Timeline for d4hfok_: