SCOPe 2.05: Domain d4hfoc_: 4hfo C:

Lineage for d4hfoc_ (4hfo C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Rhodnius prolixus [TaxId:13249] [193297] (8 PDB entries)

8. Domain d4hfoc_: 4hfo C: [252430]
   automated match to d4ge1a_

Details for d4hfoc_

PDB Entry: 4hfo, 3 Å

PDB Description: biogenic amine-binding protein selenomethionine derivative

PDB Compounds: (C:) Biogenic amine-binding protein

SCOPe Domain Sequences for d4hfoc_:

Sequence; same for both SEQRES and ATOM records:

>d4hfoc_ b.60.1.0 (C:) automated matches {Rhodnius prolixus [TaxId: 13249]}
cstvdtvkdfnkdnfftgswymthyklgdstlevgdknctkflhqktadgkikevfsnyn
pnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysvvh
vcdpaapdyymyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqyddetl
qkllkqsfpnyek

Timeline for d4hfoc_:

• d4hfoc_ first appeared in SCOPe 2.04
  
• d4hfoc_ appears in SCOPe 2.06
  
• d4hfoc_ appears in the current release, SCOPe 2.08