SCOP 1.55: Domain d1asyb1: 1asy B:68-204

Lineage for d1asyb1 (1asy B:68-204)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)

8. Domain d1asyb1: 1asy B:68-204 [25243]
   Other proteins in same PDB: d1asya2, d1asyb2

Details for d1asyb1

PDB Entry: 1asy, 3 Å

PDB Description: class ii aminoacyl transfer rna synthetases: crystal structure of yeast aspartyl-trna synthetase complexed with trna asp

SCOP Domain Sequences for d1asyb1:

Sequence; same for both SEQRES and ATOM records:

>d1asyb1 b.40.4.1 (B:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

Timeline for d1asyb1:

• d1asyb1 appears in SCOP 1.57
  
• d1asyb1 appears in the current release, SCOPe 2.08