Lineage for d4hf5l2 (4hf5 L:108-208)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763529Domain d4hf5l2: 4hf5 L:108-208 [252427]
    Other proteins in same PDB: d4hf5a_, d4hf5b_, d4hf5l1
    automated match to d2fb4l2

Details for d4hf5l2

PDB Entry: 4hf5 (more details), 3 Å

PDB Description: crystal structure of fab 8f8 in complex a h2n2 influenza virus hemagglutinin
PDB Compounds: (L:) Fab 8F8 light chain

SCOPe Domain Sequences for d4hf5l2:

Sequence, based on SEQRES records: (download)

>d4hf5l2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Sequence, based on observed residues (ATOM records): (download)

>d4hf5l2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqlvclisdfypgavtvgvetttpskqsnnkyaassylsltpe
qwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4hf5l2:

Click to download the PDB-style file with coordinates for d4hf5l2.
(The format of our PDB-style files is described here.)

Timeline for d4hf5l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hf5l1