SCOPe 2.08: Domain d4hf5l1: 4hf5 L:3-107

Lineage for d4hf5l1 (4hf5 L:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4hf5l1: 4hf5 L:3-107 [252426]
   Other proteins in same PDB: d4hf5a1, d4hf5a2, d4hf5b_, d4hf5l2
   automated match to d2mcg11

Details for d4hf5l1

PDB Entry: 4hf5, 3 Å

PDB Description: crystal structure of fab 8f8 in complex a h2n2 influenza virus hemagglutinin

PDB Compounds: (L:) Fab 8F8 light chain

SCOPe Domain Sequences for d4hf5l1:

Sequence; same for both SEQRES and ATOM records:

>d4hf5l1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspsasgtpgqaitiscsgsssnigsnpvnwyqqlpgaapklliyadehrpsgvpdr
fsgsksgtsaslaisglqsedeadyycaawddslsgpavvfgggtkltvlg

Timeline for d4hf5l1:

• d4hf5l1 first appeared in SCOPe 2.04
  
• d4hf5l1 appears in SCOPe 2.07