Lineage for d4hf5b_ (4hf5 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969855Domain d4hf5b_: 4hf5 B: [252425]
    Other proteins in same PDB: d4hf5a_, d4hf5l1, d4hf5l2
    automated match to d2viub_

Details for d4hf5b_

PDB Entry: 4hf5 (more details), 3 Å

PDB Description: crystal structure of fab 8f8 in complex a h2n2 influenza virus hemagglutinin
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4hf5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hf5b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d4hf5b_:

Click to download the PDB-style file with coordinates for d4hf5b_.
(The format of our PDB-style files is described here.)

Timeline for d4hf5b_: