![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries) |
![]() | Domain d1asya1: 1asy A:68-204 [25242] Other proteins in same PDB: d1asya2, d1asyb2 protein/RNA complex |
PDB Entry: 1asy (more details), 2.9 Å
SCOPe Domain Sequences for d1asya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asya1 b.40.4.1 (A:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl eihitkiytisetpeal
Timeline for d1asya1: