Lineage for d1asya1 (1asy A:68-204)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374538Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 374539Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 374543Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)
  8. 374547Domain d1asya1: 1asy A:68-204 [25242]
    Other proteins in same PDB: d1asya2, d1asyb2

Details for d1asya1

PDB Entry: 1asy (more details), 3 Å

PDB Description: class ii aminoacyl transfer rna synthetases: crystal structure of yeast aspartyl-trna synthetase complexed with trna asp

SCOP Domain Sequences for d1asya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asya1 b.40.4.1 (A:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

SCOP Domain Coordinates for d1asya1:

Click to download the PDB-style file with coordinates for d1asya1.
(The format of our PDB-style files is described here.)

Timeline for d1asya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1asya2