SCOP 1.57: Domain d1asya1: 1asy A:68-204

Lineage for d1asya1 (1asy A:68-204)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)

8. Domain d1asya1: 1asy A:68-204 [25242]
   Other proteins in same PDB: d1asya2, d1asyb2

Details for d1asya1

PDB Entry: 1asy, 3 Å

PDB Description: class ii aminoacyl transfer rna synthetases: crystal structure of yeast aspartyl-trna synthetase complexed with trna asp

SCOP Domain Sequences for d1asya1:

Sequence; same for both SEQRES and ATOM records:

>d1asya1 b.40.4.1 (A:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

Timeline for d1asya1:

• d1asya1 first appeared (with stable ids) in SCOP 1.55
  
• d1asya1 appears in SCOP 1.59
  
• d1asya1 appears in the current release, SCOPe 2.08