Lineage for d4hana1 (4han A:-1-154)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781960Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)
  8. 1782023Domain d4hana1: 4han A:-1-154 [252411]
    automated match to d3ap6d_
    complexed with nad, peg

Details for d4hana1

PDB Entry: 4han (more details), 2.55 Å

PDB Description: crystal structure of galectin 8 with ndp52 peptide
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d4hana1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hana1 b.29.1.0 (A:-1-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkp
radvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvav
ngkhtllyghrigpekidtlgiygkvnihsigfsfs

SCOPe Domain Coordinates for d4hana1:

Click to download the PDB-style file with coordinates for d4hana1.
(The format of our PDB-style files is described here.)

Timeline for d4hana1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hana2