Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein multi-copper oxidase CueO [69194] (1 species) |
Species Escherichia coli [TaxId:562] [69195] (38 PDB entries) |
Domain d4haka1: 4hak A:29-170 [252405] Other proteins in same PDB: d4haka4 automated match to d1kv7a1 complexed with act, cu, oh; mutant |
PDB Entry: 4hak (more details), 1.4 Å
SCOPe Domain Sequences for d4haka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4haka1 b.6.1.3 (A:29-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt grqvamglaglvvieddeilkl
Timeline for d4haka1: