SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4h9ga2 (4h9g A:213-312)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054227Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2054536Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2054537Protein automated matches [226946] (22 species)
    not a true protein
  7. 2054648Species Thermus thermophilus [TaxId:274] [256284] (6 PDB entries)
  8. 2054650Domain d4h9ga2: 4h9g A:213-312 [252403]
    Other proteins in same PDB: d4h9ga1, d4h9ga3
    automated match to d1b23p1
    complexed with 14j, gnp, mg, nh4, so4

Details for d4h9ga2

PDB Entry: 4h9g (more details), 1.93 Å

PDB Description: Probing EF-Tu with a very small brominated fragment library identifies the CCA pocket
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4h9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9ga2 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d4h9ga2:

Click to download the PDB-style file with coordinates for d4h9ga2.
(The format of our PDB-style files is described here.)

Timeline for d4h9ga2: