![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) ![]() automatically mapped to Pfam PF10436 |
![]() | Family a.29.5.0: automated matches [230678] (1 protein) not a true family |
![]() | Protein automated matches [230679] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries) |
![]() | Domain d4h85a1: 4h85 A:44-185 [252400] Other proteins in same PDB: d4h85a2 automated match to d3tz0a1 complexed with adp, hri, k, mg |
PDB Entry: 4h85 (more details), 2.1 Å
SCOPe Domain Sequences for d4h85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h85a1 a.29.5.0 (A:44-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhelyiraf qkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvryfldkt ltsrlgirmlathhlalhedkp
Timeline for d4h85a1: