Lineage for d1asza1 (1asz A:68-204)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14053Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 14054Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)
  7. 14055Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)
  8. 14057Domain d1asza1: 1asz A:68-204 [25240]
    Other proteins in same PDB: d1asza2, d1aszb2

Details for d1asza1

PDB Entry: 1asz (more details), 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction

SCOP Domain Sequences for d1asza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asza1 b.40.4.1 (A:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

SCOP Domain Coordinates for d1asza1:

Click to download the PDB-style file with coordinates for d1asza1.
(The format of our PDB-style files is described here.)

Timeline for d1asza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1asza2