SCOPe 2.08: Domain d4h83f2: 4h83 F:148-386

Lineage for d4h83f2 (4h83 F:148-386)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries)

8. Domain d4h83f2: 4h83 F:148-386 [252399]
   Other proteins in same PDB: d4h83a1, d4h83b1, d4h83c1, d4h83d1, d4h83e1, d4h83f1
   automated match to d3bjsa2
   complexed with bct, gol, na, po4

Details for d4h83f2

PDB Entry: 4h83, 2.09 Å

PDB Description: Crystal structure of Mandelate racemase/muconate lactonizing enzyme (EFI target:502127)

PDB Compounds: (F:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h83f2:

Sequence; same for both SEQRES and ATOM records:

>d4h83f2 c.1.11.0 (F:148-386) automated matches {Marine actinobacterium [TaxId: 312284]}
yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag
ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag
qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl
lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvs

Timeline for d4h83f2:

• d4h83f2 first appeared in SCOPe 2.04
  
• d4h83f2 appears in SCOPe 2.07