Lineage for d4h83e1 (4h83 E:19-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948305Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries)
  8. 2948310Domain d4h83e1: 4h83 E:19-147 [252396]
    Other proteins in same PDB: d4h83a2, d4h83b2, d4h83c2, d4h83d2, d4h83e2, d4h83f2
    automated match to d3bjsa1
    complexed with bct, gol, na, po4

Details for d4h83e1

PDB Entry: 4h83 (more details), 2.09 Å

PDB Description: Crystal structure of Mandelate racemase/muconate lactonizing enzyme (EFI target:502127)
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h83e1:

Sequence, based on SEQRES records: (download)

>d4h83e1 d.54.1.0 (E:19-147) automated matches {Marine actinobacterium [TaxId: 312284]}
gltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdid
riiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalk
mplwklwgg

Sequence, based on observed residues (ATOM records): (download)

>d4h83e1 d.54.1.0 (E:19-147) automated matches {Marine actinobacterium [TaxId: 312284]}
gltitrietipmvaplrativtrvhtdagiigeaytgdehetmfdidriiheelaptlig
qdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

SCOPe Domain Coordinates for d4h83e1:

Click to download the PDB-style file with coordinates for d4h83e1.
(The format of our PDB-style files is described here.)

Timeline for d4h83e1: