Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries) |
Domain d1eova1: 1eov A:71-204 [25239] Other proteins in same PDB: d1eova2 |
PDB Entry: 1eov (more details), 2.3 Å
SCOPe Domain Sequences for d1eova1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} akdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlafltl rqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnleih itkiytisetpeal
Timeline for d1eova1: