Lineage for d1eova1 (1eov A:71-204)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries) 
Domain d1eova1: 1eov A:71-204 [25239]
Other proteins in same PDB: d1eova2
Details for d1eova1
PDB Entry: 1eov (more details), 2.3 Å
PDB Description: free aspartyl-trna synthetase (asprs) (e.c. 6.1.1.12) from yeast
SCOP Domain Sequences for d1eova1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
akdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlafltl
rqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnleih
itkiytisetpeal
SCOP Domain Coordinates for d1eova1:
Click to download the PDB-style file with coordinates for d1eova1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eova1:
- d1eova1 appears in SCOP 1.57
- d1eova1 appears in the current release, SCOPe 2.08
View in 3D
