Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) automatically mapped to Pfam PF10436 |
Family a.29.5.0: automated matches [230678] (1 protein) not a true family |
Protein automated matches [230679] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries) |
Domain d4h81a1: 4h81 A:43-185 [252386] Other proteins in same PDB: d4h81a2 automated match to d3tz0a1 complexed with adp, k, mg, wj2 |
PDB Entry: 4h81 (more details), 2.05 Å
SCOPe Domain Sequences for d4h81a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h81a1 a.29.5.0 (A:43-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} tmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhelyira fqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvryfldk tltsrlgirmlathhlalhedkp
Timeline for d4h81a1: