Lineage for d4h81a1 (4h81 A:43-185)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1995156Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1995202Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 1995203Protein automated matches [230679] (2 species)
    not a true protein
  7. 1995218Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries)
  8. 1995220Domain d4h81a1: 4h81 A:43-185 [252386]
    Other proteins in same PDB: d4h81a2
    automated match to d3tz0a1
    complexed with adp, k, mg, wj2

Details for d4h81a1

PDB Entry: 4h81 (more details), 2.05 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/(r)-2-chloro-3-phenylpropanoic acid complex with adp
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4h81a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h81a1 a.29.5.0 (A:43-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhelyira
fqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvryfldk
tltsrlgirmlathhlalhedkp

SCOPe Domain Coordinates for d4h81a1:

Click to download the PDB-style file with coordinates for d4h81a1.
(The format of our PDB-style files is described here.)

Timeline for d4h81a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h81a2