Lineage for d4h7qa2 (4h7q A:186-375)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213541Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2213560Protein automated matches [230554] (2 species)
    not a true protein
  7. 2213576Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (13 PDB entries)
  8. 2213582Domain d4h7qa2: 4h7q A:186-375 [252385]
    Other proteins in same PDB: d4h7qa1
    automated match to d3tz0a2
    complexed with adp, coi, k, mg

Details for d4h7qa2

PDB Entry: 4h7q (more details), 2.1 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase in complex with alpha-ketoisocaproic acid and adp
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4h7qa2:

Sequence, based on SEQRES records: (download)

>d4h7qa2 d.122.1.4 (A:186-375) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhidg

Sequence, based on observed residues (ATOM records): (download)

>d4h7qa2 d.122.1.4 (A:186-375) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhidg

SCOPe Domain Coordinates for d4h7qa2:

Click to download the PDB-style file with coordinates for d4h7qa2.
(The format of our PDB-style files is described here.)

Timeline for d4h7qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h7qa1