Lineage for d1buvt_ (1buv T:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398847Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2398848Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2398863Protein TIMP-2 [50246] (2 species)
  7. 2398864Species Cow (Bos taurus) [TaxId:9913] [50248] (3 PDB entries)
  8. 2398866Domain d1buvt_: 1buv T: [25238]
    Other proteins in same PDB: d1buvm_
    complexed with ca, zn

Details for d1buvt_

PDB Entry: 1buv (more details), 2.75 Å

PDB Description: crystal structure of the mt1-mmp-timp-2 complex
PDB Compounds: (T:) protein (metalloproteinase inhibitor (timp-2))

SCOPe Domain Sequences for d1buvt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buvt_ b.40.3.1 (T:) TIMP-2 {Cow (Bos taurus) [TaxId: 9913]}
cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aapp

SCOPe Domain Coordinates for d1buvt_:

Click to download the PDB-style file with coordinates for d1buvt_.
(The format of our PDB-style files is described here.)

Timeline for d1buvt_: