SCOP 1.57: Domain d1buvt_: 1buv T:

Lineage for d1buvt_ (1buv T:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.3: TIMP-like [50242] (2 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)

6. Protein TIMP-2 [50246] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50248] (2 PDB entries)

8. Domain d1buvt_: 1buv T: [25238]
   Other proteins in same PDB: d1buvm_

Details for d1buvt_

PDB Entry: 1buv, 2.75 Å

PDB Description: crystal structure of the mt1-mmp-timp-2 complex

SCOP Domain Sequences for d1buvt_:

Sequence; same for both SEQRES and ATOM records:

>d1buvt_ b.40.3.1 (T:) TIMP-2 {Cow (Bos taurus)}
cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aapp

Timeline for d1buvt_:

• d1buvt_ first appeared (with stable ids) in SCOP 1.55
  
• d1buvt_ appears in SCOP 1.59
  
• d1buvt_ appears in the current release, SCOPe 2.08