Lineage for d1buvt_ (1buv T:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.3: Tissue inhibitor of metalloproteinases, TIMP [50242] (1 family) 
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) Protein TIMP-2 [50246] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50248] (2 PDB entries) 
Domain d1buvt_: 1buv T: [25238]
Other proteins in same PDB: d1buvm_
Details for d1buvt_
PDB Entry: 1buv (more details), 2.75 Å
PDB Description: crystal structure of the mt1-mmp-timp-2 complex
SCOP Domain Sequences for d1buvt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buvt_ b.40.3.1 (T:) TIMP-2 {Cow (Bos taurus)}
cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aapp
SCOP Domain Coordinates for d1buvt_:
Click to download the PDB-style file with coordinates for d1buvt_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buvt_:
- d1buvt_ appears in SCOP 1.57
- d1buvt_ appears in the current release, SCOPe 2.08
View in 3D
