Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.3: TIMP-like [50242] (4 families) |
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) contains an irregular alpha+beta subdomain in the C-terminal extension automatically mapped to Pfam PF00965 |
Protein TIMP-2 [50246] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [50248] (3 PDB entries) |
Domain d1buvt_: 1buv T: [25238] Other proteins in same PDB: d1buvm_ complexed with ca, zn |
PDB Entry: 1buv (more details), 2.75 Å
SCOPe Domain Sequences for d1buvt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buvt_ b.40.3.1 (T:) TIMP-2 {Cow (Bos taurus) [TaxId: 9913]} cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg aapp
Timeline for d1buvt_: