Lineage for d4h3zb_ (4h3z B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1629957Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1629958Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1630097Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 1630098Protein automated matches [190961] (13 species)
    not a true protein
  7. 1630113Species Burkholderia phymatum [TaxId:391038] [256282] (2 PDB entries)
  8. 1630115Domain d4h3zb_: 4h3z B: [252377]
    automated match to d1uala_
    complexed with cl, sah

Details for d4h3zb_

PDB Entry: 4h3z (more details), 2.15 Å

PDB Description: Crystal structure of a symmetric dimer of a tRNA (guanine-(N(1)-)-methyltransferase from Burkholderia phymatum bound to S-adenosyl homocystein in both half-sites
PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4h3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h3zb_ c.116.1.0 (B:) automated matches {Burkholderia phymatum [TaxId: 391038]}
gsmqfdivtlfpdmfraltdwgitsraakqeryglrtwnprdfttdnyrtiddrpygggp
gmvmlarpledainaakaaqaeqgiggarvvmmspqgatlnhdkvmrfaaepglillcgr
yeaidqrlidrvvdeevslgdfvlsggelpamalidavvrhlpgvlndaqsavqdsfvdg
lldcphytrpeeydgvrvpdvllgghhaeieqwrrrealrntwlkrpdlivqarknklls
radeawlaslakdask

SCOPe Domain Coordinates for d4h3zb_:

Click to download the PDB-style file with coordinates for d4h3zb_.
(The format of our PDB-style files is described here.)

Timeline for d4h3zb_: