| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
| Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
| Protein automated matches [190961] (22 species) not a true protein |
| Species Burkholderia phymatum [TaxId:391038] [256282] (2 PDB entries) |
| Domain d4h3zb1: 4h3z B:1-254 [252377] Other proteins in same PDB: d4h3za2, d4h3zb2 automated match to d1uala_ complexed with cl, sah |
PDB Entry: 4h3z (more details), 2.15 Å
SCOPe Domain Sequences for d4h3zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h3zb1 c.116.1.0 (B:1-254) automated matches {Burkholderia phymatum [TaxId: 391038]}
mqfdivtlfpdmfraltdwgitsraakqeryglrtwnprdfttdnyrtiddrpygggpgm
vmlarpledainaakaaqaeqgiggarvvmmspqgatlnhdkvmrfaaepglillcgrye
aidqrlidrvvdeevslgdfvlsggelpamalidavvrhlpgvlndaqsavqdsfvdgll
dcphytrpeeydgvrvpdvllgghhaeieqwrrrealrntwlkrpdlivqarknkllsra
deawlaslakdask
Timeline for d4h3zb1: