Lineage for d4h3ya1 (4h3y A:1-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921443Species Burkholderia phymatum [TaxId:391038] [256282] (2 PDB entries)
  8. 2921446Domain d4h3ya1: 4h3y A:1-254 [252374]
    Other proteins in same PDB: d4h3ya2, d4h3yb2
    automated match to d1uala_
    complexed with cl, sah

Details for d4h3ya1

PDB Entry: 4h3y (more details), 2.5 Å

PDB Description: Crystal structure of an asymmetric dimer of a tRNA (guanine-(N(1)-)-methyltransferase from Burkholderia phymatum bound to S-adenosyl homocystein in one half-site
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4h3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h3ya1 c.116.1.0 (A:1-254) automated matches {Burkholderia phymatum [TaxId: 391038]}
mqfdivtlfpdmfraltdwgitsraakqeryglrtwnprdfttdnyrtiddrpygggpgm
vmlarpledainaakaaqaeqgiggarvvmmspqgatlnhdkvmrfaaepglillcgrye
aidqrlidrvvdeevslgdfvlsggelpamalidavvrhlpgvlndaqsavqdsfvdgll
dcphytrpeeydgvrvpdvllgghhaeieqwrrrealrntwlkrpdlivqarknkllsra
deawlaslakdask

SCOPe Domain Coordinates for d4h3ya1:

Click to download the PDB-style file with coordinates for d4h3ya1.
(The format of our PDB-style files is described here.)

Timeline for d4h3ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h3ya2