Lineage for d4h34a2 (4h34 A:111-218)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206931Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2206932Protein automated matches [190561] (4 species)
    not a true protein
  7. 2206933Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries)
  8. 2206985Domain d4h34a2: 4h34 A:111-218 [252371]
    Other proteins in same PDB: d4h34a3
    automated match to d2shpa3
    complexed with edo, gol; mutant

Details for d4h34a2

PDB Entry: 4h34 (more details), 2.7 Å

PDB Description: crystal structure of the tyrosine phosphatase shp-2 with q506p mutation
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4h34a2:

Sequence, based on SEQRES records: (download)

>d4h34a2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records): (download)

>d4h34a2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtskvthvmircqelkydv
gggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d4h34a2:

Click to download the PDB-style file with coordinates for d4h34a2.
(The format of our PDB-style files is described here.)

Timeline for d4h34a2: