Lineage for d4h34a1 (4h34 A:4-110)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662299Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)
  8. 1662331Domain d4h34a1: 4h34 A:4-110 [252370]
    Other proteins in same PDB: d4h34a3
    automated match to d2shpa2
    complexed with edo, gol; mutant

Details for d4h34a1

PDB Entry: 4h34 (more details), 2.7 Å

PDB Description: crystal structure of the tyrosine phosphatase shp-2 with q506p mutation
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4h34a1:

Sequence, based on SEQRES records: (download)

>d4h34a1 d.93.1.0 (A:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records): (download)

>d4h34a1 d.93.1.0 (A:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqvielkyplncadptse

SCOPe Domain Coordinates for d4h34a1:

Click to download the PDB-style file with coordinates for d4h34a1.
(The format of our PDB-style files is described here.)

Timeline for d4h34a1: