Lineage for d4h1oa1 (4h1o A:2-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965816Domain d4h1oa1: 4h1o A:2-110 [252366]
    Other proteins in same PDB: d4h1oa3
    automated match to d2shpa2
    complexed with edo; mutant

Details for d4h1oa1

PDB Entry: 4h1o (more details), 2.2 Å

PDB Description: crystal structure of the tyrosine phosphatase shp-2 with d61g mutation
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4h1oa1:

Sequence, based on SEQRES records: (download)

>d4h1oa1 d.93.1.0 (A:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgg
yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records): (download)

>d4h1oa1 d.93.1.0 (A:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgg
yydlyggekfatlaelvqyymehhgqlkdvielkyplncadptse

SCOPe Domain Coordinates for d4h1oa1:

Click to download the PDB-style file with coordinates for d4h1oa1.
(The format of our PDB-style files is described here.)

Timeline for d4h1oa1: