Lineage for d4h1id_ (4h1i D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212254Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2212316Domain d4h1id_: 4h1i D: [252365]
    automated match to d4eb4a_
    complexed with so4

Details for d4h1id_

PDB Entry: 4h1i (more details), 3.1 Å

PDB Description: Structure of human thymidylate synthase at low salt conditions
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d4h1id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h1id_ d.117.1.1 (D:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d4h1id_:

Click to download the PDB-style file with coordinates for d4h1id_.
(The format of our PDB-style files is described here.)

Timeline for d4h1id_: